Sequence:
MAYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPAKSE
with polyhistidine tag at the N-terminus

Source:
Escherichia coli

Purity:
>98% as determined by SDS-PAGE. Ni-NTA chromatography

Endotoxin Test:
<0.1 EU/μg by LAL method

Bioactivity (ED50):
2.349 ng/mL measured by its ability to induce MCF-7 cells proliferation.

Suggested application:
It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

SDS-PAGE analysis of recombinant human IGF-II



Storage: 
Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. The protein was lyophilized from a solution containing 1XPBS, pH 8.0. Please use finished within one month after protein reconstitution.